PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_21390_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family TALE
Protein Properties Length: 316aa    MW: 35846 Da    PI: 6.3485
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_21390_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.41.4e-092422781955
                                           HHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
                              Homeobox  19 FeknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                                            +k +yps++++  LA+++gL+++q+ +WF N+R ++
  cra_locus_21390_iso_1_len_1024_ver_3 242 HYKWPYPSETQKLALAESTGLDQKQINNWFINQRKRH 278
                                           44679*****************************885 PP

2ELK41.33.1e-14198219122
                                   ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                                           ELK qLlrKYsgyLgsLkqEF+
  cra_locus_21390_iso_1_len_1024_ver_3 198 ELKGQLLRKYSGYLGSLKQEFM 219
                                           9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012556.6E-2057101IPR005540KNOX1
PfamPF037902.2E-225997IPR005540KNOX1
SMARTSM012561.6E-26108159IPR005541KNOX2
PfamPF037913.7E-21111157IPR005541KNOX2
SMARTSM011882.8E-8198219IPR005539ELK domain
PfamPF037895.1E-11198219IPR005539ELK domain
PROSITE profilePS5121311.174198218IPR005539ELK domain
PROSITE profilePS5007113.119218281IPR001356Homeobox domain
SMARTSM003894.1E-13220285IPR001356Homeobox domain
SuperFamilySSF466899.84E-20220292IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.2E-28223283IPR009057Homeodomain-like
CDDcd000861.44E-12230282No hitNo description
PfamPF059208.9E-17238277IPR008422Homeobox KN domain
PROSITE patternPS000270256279IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009934Biological Processregulation of meristem structural organization
GO:0048440Biological Processcarpel development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
XATSNQNNHR QPPSNSMMLQ QQQEDSHHNN NVVTAATAVG CYFMDDNINN IDGSSSNSVK  60
AKIMSHPHYH RLLAAYINCQ KIGAPPDVVA RLEEACSSAA ATMVRSSSSS CIGEDPALDQ  120
FMEAYCEMLT KYEQELSKPF KEAMLFLSRI ECQFKALSLA TSSHDSAMAE AAVDRNGSSE  180
EDVDVNNSFV DPQAEDRELK GQLLRKYSGY LGSLKQEFMK KRKKGKLPKE ARQQLLDWWE  240
KHYKWPYPSE TQKLALAEST GLDQKQINNW FINQRKRHWK PSEDMQFVVM DATQSHYYMD  300
NVLGNPFPMD ISPALL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1213222LKQEFMKKRK
2219223KKRKK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00675ChIP-seqTransfer from GRMZM2G017087Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002518420.11e-166PREDICTED: homeobox protein SBH1
SwissprotP466081e-148HSBH1_SOYBN; Homeobox protein SBH1
TrEMBLA0A068U8C31e-170A0A068U8C3_COFCA; Uncharacterized protein
STRINGVIT_10s0116g00190.t011e-163(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA68352433